PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G109500.9
Common NameB456_007G109500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 440aa    MW: 48870.1 Da    PI: 9.2959
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G109500.9genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.23e-188703498
                        SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                  B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                        ++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +++el+v+v+r
  Gorai.007G109500.9  8 QELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGDNGELRVGVRR 70
                        58999*********************************************..3489999****98 PP

2Auxin_resp106.72.7e-3596175183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aaha++t++ F v+Y+Pr+  s+F++ v+k+++a+++ +svGmRfkm+fe+eds+err++Gt+vgv d++p +W++SkWrsLk
  Gorai.007G109500.9  96 AAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERRFTGTIVGVGDISP-HWSESKWRSLK 175
                         79****************6..9***********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.675172IPR003340B3 DNA binding domain
SMARTSM010190.0022272IPR003340B3 DNA binding domain
SuperFamilySSF1019364.97E-23499IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.1E-25585IPR015300DNA-binding pseudobarrel domain
PfamPF023627.0E-16770IPR003340B3 DNA binding domain
CDDcd100171.65E-14870No hitNo description
PfamPF065071.5E-3296175IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MNLATPTQEL VAKDLHGYEW RFKHIFRGQP RRHLLTTGWS TFVTSKRLVA GDAFVFLRGD  60
NGELRVGVRR LARQQSTMPS SVISSQSMHL GVLATAAHAV TTHTLFVVYY KPRTSQFIIG  120
VNKYLEAINN GFSVGMRFKM RFEGEDSPER RFTGTIVGVG DISPHWSESK WRSLKIQWDE  180
PAAIQRPERV SPWEIEPFVA SASTNAQPTI MCKRPRPVDI PASEITTSSA GSAFWCRESI  240
QSHELTPVGS TLEVQSSENQ VMWPMRQKEA DNCLINGNGG YKSRTPPENA WPPSPLVNVS  300
LNLFPDSMEN NYKTGALQTA LTGYAKGLMH DQVEKRKTET FTGCRLFGFN LTDSTSVAAP  360
PDKEQTSTSI DYNGVRGHVP AAFHVEQKPE TSKEQKQVAS ETSTQEMQAK QGSATSMRSR  420
TKVNFTVSAS LDCIHYSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-981198155355Auxin response factor 1
4ldw_A1e-981198155355Auxin response factor 1
4ldw_B1e-981198155355Auxin response factor 1
4ldx_A1e-981198155355Auxin response factor 1
4ldx_B1e-981198155355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212216KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5670004e-40AJ567000.1 Gossypium hirsutum microsatellite DNA mGhCIR051, clone CIR051.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490133.10.0PREDICTED: auxin response factor 18-like isoform X3
SwissprotQ9C5W91e-123ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D2SI000.0A0A0D2SI00_G
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.11e-108auxin response factor 18
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]